Biology question and answers for October 05, 2023
- Q Which of the following statements regarding diacylglycerol (DAG)and inositol triphosphate (IP3) is not true?A. They only bind to very specfic cell surface receptorsB. Both are important second messanger moleculesC. They...
- Q describe the life cycle of a specific helminth ( includingterminology)
- Q outline the lytic and lysogenic cycle of a bacteriophage
- Q Discuss the significance of physical barriers ingluconeogenesis.
- Q BRIEFLY describe the rationale for doingtransfection experiments in mammalian cells.
- Q how is potential energy and kinetic energy converted from one toanother in photosythesis and cell respiration?what are the effects of light energy in an atom?what is the ATP structure and...
- Q to 5’ bond without a nucleotide also beingadded.Group of answer choicesPrimaseHelicasesingle stranded binding (SSB. proteinsTopoisomeraseDNA LigaseDNA Polymerase IIIDNA Polymerase I
- Q Describe the differences in marriage and family life that arelinked to class, race, gender, and personal choice.
- Q whyare tapeworms in a class of their own?
- Q What happens to the electrons from water that was split into O2and H+?What does the water-splitting photosystem produce for the CalvinCycle?What does the NADPH producing photosystem produce for the CalvinCycle?How...
- Q PREPARATION OF COMPETENT CELLS andTRANSFORMATION:2a. We will be preparing competent MM294 (E.coli) cells using a chemical treatment of CaCl2.What are MM294 cells, why do we use them? Define “competent†cellsand...
- Q Compare and contrast the digestion of proteins and lipids.Include at least two similarities and two differences.
- Q The allele b gives Drosophila flies a blackbody, and b+ gives brown, the wild-type phenotype. Theallele wx of a separate gene gives waxy wings, andwx+ gives nonwaxy, the wild-type phenotype....
- Q what are the 12 nerve in the NS and where can we find them and whatare their functions?? in a simple way?
- Q 53. Females are likely to mate with more than one male whenSelect one:a. resources can�t be monopolized, as in robins who eatworms.b. only some males are able to get good...
- Q What does the title phrase ‘overcrowded milieu’ mean in the contextof intrinsically disordered proteins, proteinaceous membrane-lessorganelles, and everything else constituting the cytoplasm? How doyou think IDPs and PMLOs fit into...
- Q Assume that you have recently been hired as the specialassistant to the chief executive officer (CEO) of your health careorganization, Thunder Hospital. Your duty is to head up the newquality...
- Q where can we find plexus and what are their function. in a simplerway
- Q how does the coronavirus replicate its genome and expresses itsgenes?How come coronaviruses are able to mutate so rapidly?
- Q What is the lipid composition of a normal human cell’s plasmamembrane (choose a cell type)? Describe and draw, in detail, thechemical structure of a lipid from your choice.
- Q 1) Define and compare the four levels of proteinorganization. How does the sequence of nucleotides of the generelate to the levels of protein organization?2) Explain transcriptional control of gene expression...
- Q Describe human mitosis in detail. How is it different than plantmeiosis? In this article, how were the organism knockdowns andknockouts produced?
- Q What ultimately characterizes different cells from each other?What makes neurons different from immune cells vs. kidney cells,etc.?
- Q Where are each of our macronutrients(carbohydrates,proteinsand fats)chemically digested? Where does the process for each ofthem begin? Also note all locations in the GI tract that theseprocesses continue (until each macronutrient...
- Q Howdo molecules enter the nucleus? What types of molecules enter thenucleus? Describe in detail how fluorescence works. What isquenching and how is it used to a researcher’s advantage? What arecell...
- Q What is the difference between molecular motion anddiffusion?
- Q Describe three types of post-transcriptional regulationof protein–coding genes
- Q Please, answer this questionIdentify the structural characteristics and functions of thecellular elements of blood.
- Q Scenario: While shopping in a local nursery, you meet Albert.Albert recently bought a new house in the Elk Grove area. He wantsto do some landscaping and put in a summer...
- Q The Human Genome Project's utility in identifying thedisease-causing gene in albinism AND it's mode of inheritance
- Q (1) Haemochromatosis is a mild autosomal recessive condition.Approximately 1 in 200 Australians have the condition, andapproximately 1 in 7 Australians are carriers. Jane is planning onstarting a family, and does...
- Q If a mutation prevented the synthesis of any of thelinker proteins, what step(s) in meiosis would not occur? Why is /are that step(s) important?
- Q Fill in the blank with A, B or A and B based on whether thefollowing statements are referring to Ionotropic receptors (A) ormetabotropic receptors (B) or both.a) ___ blocked by...
- Q Cheney and Seyfarth recorded one vervet monkey making acall that indicates danger from another group of vervets(wrrr)• They played the wrrr call to the group, and groupbegan to ignore it•...
- Q IBMX is isobutyl methyl xanthine, one of several modifiedxanthines (purines) that act as phosphodiesterase inhibitors. Howand where would IBMX effect the PKA pathway?
- Q Please, answer this questionIdentify the hormones of the anterior and posterior pituitaryalong with their target organs and their functions.
- Q what do you suggest me for writing a master thesis of medicalstudent ??please suggest me as much as more topics you guess
- Q Carry out a BLAST search against the UniProt database using thefollowing sequence as input:MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK-- Select from the list below ALL statements that are TRUE. *The name of the protein is...
- Q What is the net reaction that HIV protease catalyzes. \ listthe substrates and products
- Q Write A summary:5.2 SHELTERING IN PLACEIn normal operations, a building does little to protectoccupants from airborne hazards outside the building becauseoutdoorair must be continuously introduced to provide a comfortable,healthy indoor...
- Q Describe the following relationships:Nucleotides and DNAGenes, intergenic regions and DNADNA, histones, and nucleosomesNucleosomes and chromatinChromatin and chromosomeDNA, nucleus, mitochondria and genome
- Q A.After studying nutrition science, you should be knowledgeable aboutnutrition guidelines and how nutrition can affect health. Pleasedemonstrate what you have learned by explaining the following:Using terms and concepts that youhave...
- Q Explain when plants and animals first showed up on earth.Include geologic time frame.
- Q State what the function(s) of the following nuclear componentsand why each is important to the cell. (Provide details, don’t justsay “ribosomes are the location of translation.†What istranslation) nuclear envelope,...
- Q While chatting about neural oscillations at a party, someonetells you that they believe that neural oscillations are exhaustfumes of the brain. Write your response to them below, and providean example...
- Q What are the sources of nitrogenous wastes in animals,and how are these converted and eliminated in theosmoregulatory systems of invertebrates, insects, bony fish,mammals and birds? Â Â
- Q Outline the functions of the following hormones in relation todigestion and/or the maintenance of metabolic balance: gastrin,cholecystokinin (CCK), insulin, glucagon and leptin.
- Q Address the following regarding Oxidative Phosphorylation?Why are the processes of the ETC and ATP Synthase alwayscoupled? What is the “oxidative†part refer to? What is the“phosphorylation†refer to?What type of...
- Q You are interested in cloning a gene from the B.sanfranciscus genome, so you design PCR primers that shouldamplify a 1 kilobase pair (kbp) PCR product that contains the geneof interest.  After...
- Q Discuss the prevention for meningitis. Please be VERYdetailed.
- Q What is protein that is related to p53 gene? How is this generegulated? What is the protein that is formed? What is specificstructure, what is function of this protein? How...
- Q How COL1A1 gene is related to collagen? How is this generegulated? How is the collagen protein that is formed? What isspecific structure, what is function of this protein? How is...
- Q for the uracil:1. Describe chemical characteristics, classification and biologicalmolecule in which it is found2. Identify each of the parts that make it up and graph nitrogenousbase, nucleoside and nucleotide.
- Q McArdle Disease (glycogen storage disease 5) is caused bymutations in the phosphorylase enzyme in muscle. The symptoms aremuscle cramps, pain, and fatigue during strenuous exercise. Anischemic exercise test is often...
- Q McArdle Disease (glycogen storage disease 5) is caused bymutations in the phosphorylase enzyme in muscle. The symptoms aremuscle cramps, pain, and fatigue during strenuous exercise. Apatient is undergoing an ischemic...
- Q discussed that all living organisms have seven properties incommon: (1) they grow and develop, (2) interact/respond to theenvironment, (3) reproduce, (4) process energy, (5) self-regulate,(6) are ordered/organized, and (7) evolve/adapt....
- Q Please Describe AND diagramwhen and how six carbons in glucose are alltransferred and released, and in what form (molecule), fromglycolysis through the Krebs (TCA) cycle. Whatelse happens each time carbons...
- Q What is the relationship between type of fertilization andreproductive environment? what is a logical reason for this?related to ( general Reproductive Patterns seen invertebrates
- Q McArdle Disease (glycogen storage disease 5) is caused bymutations in the phosphorylase enzyme in muscle. The symptoms aremuscle cramps, pain, and fatigue during strenuous exercise. A) Anischemic exercise test is...
- Q The regulation of aspartate derived amino acids in Arabidopsisthaliana is depicted as an integrated network involving pathway endproducts that act as allosteric effectors on enzymes inintermediate steps.Explain the downstream consequence...
- Q Describe the factors that effect enzymatic rate. Include graphs inyour explanations.
- Q Youhave purified the peotide hormone that binds to the receptor below.To determine its amino acid sequence you digested the polypeptidewith trypsin and in a separate reaction you cleaved the polypeptidewith...
- Q I need the results of the F1 and F2 generation using PunnetSquare for:1. Monohybrid cross between Parent gen. phenotypes scarlet andsepia drosophila2. Dihybrid cross between Parent gen. phentotypes scarlet andyellow...
- Q TCA cycles, starting from two pyruvates to 6 CO2, generate2 ATP, 8 NADH, and 2 FADH. How many ATPs aregenerated at each of the following processes? (use the data givenhere...
- Q Global CO2 concentration is rising rapidly. Which type of plantsare more likely to benefit from the increased CO2concentration?C3 plants benefit most.Reason why?
- Q What are the three types of FDA meetings? How are these meetingsarranged?
- Q Describe the results you would get back if you performed aChip-Seq experiment for an E. coli strain containing plasmid RK2,to investigate where DnaA-ATP binding occurs throughout the genome.Will you find...
- Q 1. Vitamins A, D, E, and K are fat-soluble vitamins becausetheir structures include a hydrocarbon chain.True or False2. Which form of vitamin E is maintained in plasma and used bythe...
- Q How important is informed consent in relation to human research?Make sure to provide clear examples to illustrate key points.
- Q I am testing the effects of a new drug, and find that livercells treated with this drug show the following effects:-Reduced levels of AcCoA in the mitochondria-Increased rates of gluconeogenesis-Increased...
- Q During the crossbridge cycle in a skeletal muscle, the next stepafter a myosin head binds to actin is that the myosinheada. changes conformation in the power stroke.b. unbinds from the...
- Q . β-Galactosidase (lacZ) has bifunctional activity. Ithydrolyzes lactose to galactose and glucose and catalyzes theintramolecular isomerization of lactose to allolactose.β-Galactosidase promotes the isomerization by means of an acceptorsite that binds...
- Q . A wild-type Hfr is mated to an F- strain that is io+ zy- . Inthe absence of inducer and glucose what should happen toβ-galactosidase levels immediately after the mating...
- Q List out the 3 different genes and their respective responses inplants that you came across, that help plants respond to differentsignals
- Q Communities have no defined spatial or temporal extent. Usingthe information and studies discussed in class (e.g., Ricklefs2008, or Brooker et al. 2009) or examples from the primaryliterature (peer-reviewed articles), in...
Get Answers to Unlimited Questions
Join us to gain access to millions of questions and expert answers. Enjoy exclusive benefits tailored just for you!
Membership Benefits:
- Unlimited Question Access with detailed Answers
- Zin AI - 3 Million Words
- 10 Dall-E 3 Images
- 20 Plot Generations
- Conversation with Dialogue Memory
- No Ads, Ever!
- Access to Our Best AI Platform: Flex AI - Your personal assistant for all your inquiries!