Basic Math question and answers for October 01, 2023
- Q Suppose x has a distribution with ? = 65 and? = 9.(a) If random samples of size n = 16 are selected, canwe say anything about the x distribution of...
- Q Let the continuous random variable X have probability densityfunction f(x) and cumulative distribution function F(x). Explainthe following issues using diagram (Graphs)a) Relationship between f(x) and F(x) for a continuousvariable,b) explaining...
- Q It is known that the thread life of a certain type of tire has anormal distribution with standard deviation of 1500.a) A sample of 16 tires is found to have...
- Q Your leader wants you to evaluate the difference in cycle timebetween three different offices. Describe the steps you would takein the evaluation in order to provide a report so the...
- Q 1a. Suppose I have a gaming web site that can only handle 10players at the same time, or else my server will crash. I have 50users. Each user is online...
- Q A large school district claims that 80% of the children are fromlow-income families. 130 children from the district are chosen toparticipate in a community project. Of the 130 only 72%...
- Q Suppose you know that the amount of time it takes your friendSusan to get from her residence to class averages 50minutes, with a standard deviation of 55 minutes. What proportionof Susan's...
- Q Do students reduce study time in classes where they achieve ahigher midterm score? In a Journal of Economic Educationarticle (Winter 2005), Gregory Krohn and Catherine O’Connor studiedstudent effort and performance...
- Q (1) According to the American Lung Association, 90% of adultsmokers started smoking before turning21 years old. Ten smokers 21 years old or older were randomlyselected, and the number of smokerswho...
- Q A large pond contains f fish, of which t have been tagged.Biologist A takes a simple random sample of nA fish from the pond.Biologist B takes a simple random sample...
- Q For staffing purposes, a retail store manager would like tostandardize the number of checkout lanes to keep open on aparticular shift. She believes that if the standard deviation ofthe hourly...
- Q Discuss the challenges a researcher would encounter intransforming an area probability face-to-face survey into an Onlinesurvey when attempting to estimate the same statistics.
- Q Components of a certain type are shipped to a supplier inbatches of ten. Suppose that 49% of all such batches contain nodefective components, 31% contain one defective component, and 20%contain...
- Q 3. Testing for equal proportionsImagine that you are contracted by a local news provider tostudy consumer demographics in relation to three different types ofnews media: print (newspaper), Internet, and television....
- Q Let S be the square centered at the origin with sides of length2, and C be the unit circle centered at the origin.(a) If you randomly throw a point on...
- Q . In s study done by the Ohio Department of Job and FamilyServices, it was determined 38 (out of 62) poor children whoattended preschool needed social services later in life...
- Q Canadian male has recently had a Prostate Specific Antigen (PSA)test as to determine if he has prostate cancer. The false-positiverate of a PSA test is 14%. If he does have...
- Q 1. Which of the following variables is an example of acategorical variable?a) The amount of money you spend on eating out each month.b) The time it takes you to write...
- Q 3. Use `sample()` to generate rolls from biased coin with$Pr(Head) = 0.6$ .i) get a sample of size 10 tosses and tally the results ii) get a sample of size 30...
- Q How does assess data stewardship considerations related to data?And how does data related issues are identified, managed, andresolved?
- Q 2. The data set `MLB-TeamBatting-S16.csv` contains MLB Team BattingData for selected variables. Load the data set from the given urlusing the code below. This data set was obtained from [BaseballReference](https://www.baseball-reference.com/leagues/MLB/2016-standard-batting.shtml).*...
- Q The method of tree ring dating gave the following years A.D. foran archaeological excavation site. Assume that the population ofx values has an approximately normal distribution.119412921285129212681316127513171275(b) Find a 90% confidence...
- Q Construct the confidence interval for the population standarddeviation for the given values. Round your answers to one decimalplace.n=20, s=4.2, and c=0.99
- Q Sales personnel for Skillings Distributors submit weekly reportslisting the customer contacts made during the week. A sample of 85weekly reports showed a sample mean of 17.5 customer contacts perweek. The...
- Q Find V(X) of the geometric distribution (Hint for the problem:Use the interchange derivative and summation, Find E(X^2), and thenuse the formula V(X) = E(X^2) - E(X)^2). Please show all work...
- Q Consider the timeseries given by yt =a1yt-1 +a2yt-2 +?t. Where?t is independent white noise andyt is stationary.A. Compute the mean ofyt.E(yt)B. Compute the variance ofyt.E[yt ?E(yt)]2C. Compute the first threeautocovariances for yt.(E[(yt?E(yt))(yt?i?E(yt?i))]i=1,2,3).
- Q The scores 30 students earned on the Calculus I final exam arelisted in the data set below (in percentage).examscores=c(95,68,65,50,82,85,91,83,70,67, 68,65,52,39,48, 75,65,70,68,65, 69,71,68,73,78,80,51,65,64,87)Include your R commands and output foreach part of...
- Q you decide that you want to examine the lead concentrations inblue crabs in the Chesapeake Bay. Before you collect the crabs, youwould like to determine how many crabs should be...
- Q Recall the researcher who investigated the relationship betweenhours of sleep and reaction times in the Week 4 Application. As afollow up to that study, the researcher wants to conduct acorrelation...
- Q Using the mtcars dataset, answer the following questions:Fill in the following table:VariableCorrelation with mpgcyl-0.85216disp-0.84755hp-0.77617drat0.681172wt-0.86766qsec0.418684vs0.664039am0.599832gear0.480285carb-0.55093mpgcyldisphpdratwtqsecvsamgearcarbMazda RX42161601103.92.6216.460144Mazda RX4 Wag2161601103.92.87517.020144Datsun 71022.84108933.852.3218.611141Hornet 4 Drive21.462581103.083.21519.441031Hornet Sportabout18.783601753.153.4417.020032Valiant18.162251052.763.4620.221031Duster 36014.383602453.213.5715.840034Merc 240D24.44146.7623.693.19201042Merc 23022.84140.8953.923.1522.91042Merc 28019.26167.61233.923.4418.31044Merc 280C17.86167.61233.923.4418.91044Merc 450SE16.48275.81803.074.0717.40033Merc 450SL17.38275.81803.073.7317.60033Merc 450SLC15.28275.81803.073.78180033Cadillac Fleetwood10.484722052.935.2517.980034Lincoln...
- Q I have no strong background in Probability, please, present tome an easy to understand solution to this problem with detailexplanation. Thank you.An urn contains three white, six red, and five...
- Q Describe and discuss at least 1 other business scenario in whichyou believe Chi-square testing would be helpful to a company.Use the following data to conduct a Chi-square test for eachregion...
- Q For 300 trading? days, the daily closing price of a stock? (in$) is well modeled by a Normal model with mean $195.89 and standarddeviation ?$7.18According to this? model, what cutoff...
- Q 1. A $1 scratch off lotto ticket will be a winner one out of 10times. Out of a shipment of n = 200 lotto tickets, using thePoisson distributions in each...
- Q Each of three barrels from a manufacturing line are classifiedas either above (a) or below (b) the target weight. Provide theordered sample space.
- Q An online poll at a popular web site asked the following:A nationwide ban of the diet supplement ephedra went into effectrecently. The herbal stimulant has been linked to 155 deaths...
- Q A retrospective study of 159 pairs of twins was performed. Thetwin pairs each had one male child and one female child. Theirbirth weights were studied to determine if the male...
- Q what is sampling risk and why is it important to understand therisk of sampling? you may use an example .
- Q (1) For this problem, carry at least fourdigits after the decimal in your calculations. Answers may varyslightly due to rounding.In a random sample of 70 professional actors, it was found...
- Q 7. Two fair six sided dice are rolled.(i) What is the probability that the sum of the two results is6?(ii) What is the probability that the larger value of the...
- Q A manufacturer of television sets is interested in the effect ontube conductivity of four different types of coating for colorpicture tubes. A completely randomized experiment is conducted, andthe following conductivity...
- Q Suppose two independent random samples of sizes n1 = 9 and n2 =7 that have been taken from two normally distributed populationshaving variances ?12 and ?22 give sample variances of...
- Q Post a clear and logical response in 150 to 200words to the following questions/prompts, providing specificexamples to support your answers.Think about examples of how using probability distribution couldaffect ethics. What...
- Q The tensile strength of a fiber used in manufacturing cloth isof interest to the purchaser. Previous experience indicates thatthe standard deviation of tensile strength is 2 psi. A randomsample of...
- Q Please do not use this as an example: Suppose a companyprinted baseball cards. It claimed that 30% of its cards wererookies; 60% were veterans but not All-Stars; and 10% were...
- Q A drug study compared the amounts of nitrate absorbed into theskin for brand name and generic formulations of the drug. The twodrugs were both applied to the arms of 14...
- Q A youth and money survey, sponsored by the american savingseducation council talked to 1,000 students about their personalfinance, ages 16-22. The survey found that 33% of students in thisage group...
- Q You may need to use the appropriate technology to answer thisquestion.Are nursing salaries in City A lower than those in City B? Asreported by a newspaper, salary data show staff...
- Q Qualitative, Quantitative, Discrete, Continuous.Required:(a) List 5 qualitative variables and 5 quantitative variablesseen around the home.(b) List 5 discrete and 5 continuous variables found at home, atwork, on TV or any...
- Q please be very specific on showing work done!!If Z?N(?=0,?2=1)Z?N(?=0,?2=1), find the followingprobabilities:P(Z<1.58)=P(Z<1.58)=P(Z=1.58)=P(Z=1.58)=P(Z>?.27)=P(Z>?.27)=P(?1.97<Z<2.46)=
- Q Abag has 3 red balls and x white balls. A random ball is dragged outfrom the bag and replaced with a ball of the other color. If asecond ball is...
- Q 7 During the period of time that a local university takesphone-in registrations, calls come in at the rate of one every twominutes.What is the probability of receiving NO calls in...
- Q QUESTION 11 Use your TI83 (or Excel): A normally distributedpopulation has a mean of 77 and a standard deviation of 15.Determine the probability that a random data has a value...
- Q You’ve been asked to carry out a quantitative analysis of yourcompany’s marketing campaign, and have been given permission togather all the data you believe necessary. Drawing on all thematerial covered...
- Q Let x represent the dollar amount spent on supermarket impulsebuying in a 10-minute (unplanned) shopping interval. Based on acertain article, the mean of the x distribution is about $31 andthe...
- Q On average, do hospitals in the United States employ fewer than900 personnel? Use the hospital database as your sample and analpha of 0.10 to test this figure as the alternative...
- Q Suppose we have a binomial experiment in which success isdefined to be a particular quality or attribute that interestsus.(a) Suppose n = 34 and p = 0.33.(For each answer, enter...
- Q 1. How many 12-digit phone numbers can be created with thefollowing restrictions:a) no restrictionsb) first number cannot be zero or one.c) no repeated numbers2. Find the number of distinguishable permutations...
- Q Introduction to Probability and StatisticsScenario: We wish to compare the commuting time in minutes tothe university of two sections of a particularMorning Section Times:39 35 39 39 40 37 41...
- Q Design your own measure of central tendency thatis:a) unaffected by extreme scoresb)Inappropriate for use on nominal or ordinal datademonstrate that your measure meets these requirements and contrastit with the commonly...
- Q 1. Suppose you would like to do a survey ofundergraduate students on your campus to find out how much time onthe average they spend studying per week. You obtain from...
- Q For this problem, carry at least four digits after the decimalin your calculations. Answers may vary slightly due torounding.A random sample of 5220 permanent dwellings on an entirereservation showed that...
- Q Activity 1: National records have shown that the distributionof time lengths (in years) needed to complete a bachelor's degreeis approximately bell-shaped (normal) where the mean is 4.6 yrs andthe standard...
- Q The test statistic for a sign test is the smaller of the numberof positive or negative signs. True False
- Q VideoSelf-Test TutorialConsider a sample with a mean of 40 and a standard deviation of5. Use Chebyshev's theorem to determine the percentage of the datawithin each of the following ranges (to...
- Q What does it mean to take a sampling of a population?Why do scientists use samplings?
- Q The accompanying data represent the pulse rates? (beats per?minute) of nine students. Treat the nine students as a population.Compute the? z-scores for all the students. Compute the mean andstandard deviation...
- Q The accompanying data represent the miles per gallon of a randomsample of cars with a? three-cylinder, 1.0 liter engine.?(a)Compute the? z-score corresponding to the individual whoobtained39.839.8miles per gallon. Interpret this...
- Q 2. A lawyer believes that a certain judge imposes prisonsentences for property crimes that are longer than the stateaverage 11.7 months. He randomly selects 36 of the judge’ssentences and obtains...
- Q Give a brief discussion, comparing and contrasting unit theorylearning curves and cumulative average theory learningcurves. Include a discussion of what the impact might beif you incorrectly used a unit theory curve...
- Q An insurance companyhas three types of annuity products: indexed annuity, fixedannuity, and variable annuity. You are given:None of the customers have both fixed annuity and variableannuity.40% of the customers with...
- Q Paul wants to estimate the mean number of siblings for eachstudent in his school. He records the number of siblings for eachof 100 randomly selected students in the school. What...
- Q Suppose 50 drug test results are given from people whouse drugs (see table below):If 2 of the 50 subjects arerandomly selected without replacement, find theprobability that the first person tested...
- Q Each front tire on a particular type of vehicle is supposed tobe filled to a pressure of 26 psi. Suppose the actual air pressurein each tire is a random variable—X...
- Q Question 1 2 ptsIn a sample of 80 adults, 28 said that they would buy a car froma friend. Three adults are selected at random without replacement.Find the probability that...
Get Answers to Unlimited Questions
Join us to gain access to millions of questions and expert answers. Enjoy exclusive benefits tailored just for you!
Membership Benefits:
- Unlimited Question Access with detailed Answers
- Zin AI - 3 Million Words
- 10 Dall-E 3 Images
- 20 Plot Generations
- Conversation with Dialogue Memory
- No Ads, Ever!
- Access to Our Best AI Platform: Flex AI - Your personal assistant for all your inquiries!